PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00026652-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family ZF-HD
Protein Properties Length: 294aa    MW: 31615.3 Da    PI: 8.8994
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00026652-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.11.6e-3182137359
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                        vrY++C+kNhAa++G+ha+DGCgEfm+s g egta+alkC ACgCHRnFHRre e 
  PSME_00026652-RA  82 IVRYRDCQKNHAANIGSHALDGCGEFMAS-GLEGTADALKCQACGCHRNFHRREIEG 137
                       689*************************9.999*********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047709.6E-2983135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-1983133IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.0E-2884135IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.59185134IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.08E-17223292IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-30224293IPR009057Homeodomain-like
TIGRFAMsTIGR015651.9E-24231288IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MMDHHHSHHQ IPVSIPPVSV HDISRLQQHQ IYHNPTSIVH ETGTGNNIHS NSNNAHFSQN  60
GNGDDAKPLV EKPKKADSVE KIVRYRDCQK NHAANIGSHA LDGCGEFMAS GLEGTADALK  120
CQACGCHRNF HRREIEGEGG SGTSSLQDGW YLGSAGRSRV DKKRLLPGGG GGGGGGAGVP  180
LFSSPSPPPT GAHASGPQML MALSSACTLG DPDLHEGLVG HGIGSSSSAM KKRFRTKFSQ  240
DQKEKMHAFA DQLGWRIQKH DEAAVQQFCN EAGVRRHVLK VWMHNNKNTL GKKS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-272322891875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6769040.0EF676904.1 Picea sitchensis clone WS02757_J24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001752347.17e-65predicted protein
SwissprotA2YWA68e-57ZHD2_ORYSI; Zinc-finger homeodomain protein 2
SwissprotQ6ZB908e-57ZHD2_ORYSJ; Zinc-finger homeodomain protein 2
TrEMBLB8LM961e-165B8LM96_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.17e-55homeobox protein 22